PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.002G225400.1
Common NameB456_002G225400, LOC105786189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 384aa    MW: 42793.8 Da    PI: 7.7985
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.002G225400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31212266155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWt++LH++Fv++v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQkYR+
  Gorai.002G225400.1 212 KTRIRWTQDLHDKFVDCVKRLGGAEKATPKAILKLMDTEGLTIFHVKSHLQKYRI 266
                         68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.441209269IPR017930Myb domain
SuperFamilySSF466891.79E-16210266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-28211267IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-24212267IPR006447Myb domain, plants
PfamPF002494.1E-8216265IPR001005SANT/Myb domain
PfamPF143791.5E-21294340IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MNTQKLDYQE NVEQNLGFSR DCNFEYVGFQ QPWNMATPMV DGTVSHHPKS SSSSTILVGF  60
QTPGAAFYAT ERCMGFPQYG SSSQGAATSF CSQYNKLCNS QLPSFHASGD NFSIQSLMKS  120
QIFCNQYEKS SDKSCTTTQD PSHDLSNLLG TNAATLPNHF SVPFRGNQDQ GAYCNSHGSS  180
PAKLSFFLQE KQSSPRSFSV SPSSTGTVLT SKTRIRWTQD LHDKFVDCVK RLGGAEKATP  240
KAILKLMDTE GLTIFHVKSH LQKYRIAKYM PDSAQGKSEK RNDLTQIDVK TGLHLTEALQ  300
LQLDVQRRLH EQLEIQRNLQ LRIEEQGRQL KMMIDQQQKT SESLLKNQDF NINPFDPSIS  360
FQDVFETSIA ESSGTGNISS KIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467979.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A0D2QAI90.0A0A0D2QAI9_G
STRINGPOPTR_0006s20540.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-75G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]